SPARC antibody Western blot. All lanes: Anti SPARC at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: 293T Whole Cell Lysate at 40 ug. Lane 3: MCF-7 Whole Cell Lysate at 40 ug. Predicted band size: 35 kD. Observed band size: 35 kD.
Osteonectin / SPARC Antibody (aa268-303)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407772-100
Catalog Number: LS-C407772
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SPARC antibody LS-C407772 is an unconjugated rabbit polyclonal antibody to human SPARC (Osteonectin) (aa268-303). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Basement-membrane protein 40 | BM-40 | Cysteine-rich protein | ON | Osteonectin | SPARC
- UniProt Number
- P09486
- NCBI GenBank
- NM_003118, NP_003109.1
- SwissProt
- P09486
Target
- Target
- Human Osteonectin / SPARC
- Antigen Species
- Hu
- Gene Name
- SPARC
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human SPARC (268-303 aa RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI), different from the related mouse and rat sequences by four amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl