
Osteonectin / SPARC Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490233-100
Catalog Number: LS-C490233
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SPARC antibody LS-C490233 is an unconjugated rabbit polyclonal antibody to human SPARC (Osteonectin). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Basement-membrane protein 40 | BM-40 | Cysteine-rich protein | ON | Osteonectin | SPARC
- UniProt Number
- P09486
- NCBI GenBank
- NM_003118 | NP_003109.1
- SwissProt
- P09486
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human Osteonectin / SPARC
- Antigen Species
- Human
- Gene Name
- SPARC
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI of human SPARC were used as the immunogen for the SPARC antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
