Western blot analysis of extracts of various cell lines, using NRXN3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

NRXN3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C496976-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: NRXN3 antibody LS-C496976 is an unconjugated rabbit polyclonal antibody to NRXN3 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: C14orf60 | KIAA0743 | Neurexin III-beta | Neurexin 3 | Neurexin III | NRXN3 | Neurexin III-alpha | Neurexin-3-beta
Recommended Dilution: WB: 1:1000 - 1:2000
UniProt Number: Q9Y4C0
NCBI GenBank: NM_004796 | NP_004787.2
SwissProt: Q9Y4C0

Target

Target: Human NRXN3
Antigen Species: Human
Gene Name: NRXN3

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 373-432 of human NRXN3 (NP_620426.2). ILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)