Western blot analysis of extracts of various cell lines, using NOVA1 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

NOVA1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C747238-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: NOVA1 antibody LS-C747238 is an unconjugated rabbit polyclonal antibody to human NOVA1. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Nova-1 | Onconeural ventral antigen 1 | RNA-binding protein Nova-1 | NOVA1 | Paraneoplastic Ri antigen
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P51513
NCBI GenBank: NM_002515 | NP_002506.2
SwissProt: P51513

Target

Target: Human NOVA1
Antigen Species: Human
Gene Name: NOVA1

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 408-507 of human NOVA1 (NP_002506.2). SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)