Monoclonal Rat anti-Mouse CD90.2 (Mouse) Antibody (clone 30H12, AF647)
Catalog Number: LS-C810655
2 sizes / from $259.00
Antibody: Rat Monoclonal
Applications: Flow Cytometry
Reactivity: Mouse
Format: Liquid
Monoclonal Mouse anti-Human RPA70 / RPA1 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Flow Cytometry, Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Non-Human Primate |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756647-100
Catalog Number: LS-C756647
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RPA1 antibody LS-C756647 is an unconjugated mouse monoclonal antibody to RPA1 (RPA70) from human. It is reactive with human, mouse and monkey. Validated for Flow, IHC and WB.
- Application
- FC, IHC-P, WB
- Reactivity
- Hu, Ms, NHP
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- HSSB | MST075 | Replication factor A protein 1 | Replication protein A1 (70kD) | RF-A | RF-A protein 1 | MSTP075 | Replication protein A1, 70kDa | RP-A | RPA1 | REPA1 | RP-A p70 | RPA70
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- Recommended Dilution: IHC-P
- 0.5 - 1 µg/ml
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P27694
- NCBI GenBank
- NM_002945, NP_002936.1
- SwissProt
- P27694
Target
- Target
- Human RPA70 / RPA1
- Antigen Species
- Hu
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- RPA1
Antibody
- Host Species
- Ms
- Clonality
- Monoclonal
- Isotype
- IgG2b
- Origin Species
- Hu
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human RPA70 (533-568 aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
