Western blot analysis of RPA70 expression in HELA whole cell lysates (lane 1), JURKAT whole cell lysates (lane 2) and COLO320 whole cell lysates (lane 3). RPA70 at 70 kD was detected using rabbit anti- RPA70 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
RPA70 / RPA1 Antibody (aa533-568)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408099-100
Catalog Number: LS-C408099
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RPA1 antibody LS-C408099 is an unconjugated rabbit polyclonal antibody to human RPA1 (RPA70) (aa533-568). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HSSB | MST075 | Replication factor A protein 1 | Replication protein A1 (70kD) | RF-A | RF-A protein 1 | MSTP075 | Replication protein A1, 70kDa | RP-A | RPA1 | REPA1 | RP-A p70 | RPA70
- UniProt Number
- P27694
- NCBI GenBank
- NM_002945 | NP_002936.1
- SwissProt
- P27694
Target
- Target
- Human RPA70 / RPA1
- Antigen Species
- Human
- Gene Name
- RPA1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human RPA70 (533-568 aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl