
RPA70 / RPA1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490557-100
Catalog Number: LS-C490557
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RPA1 antibody LS-C490557 is an unconjugated rabbit polyclonal antibody to human RPA1 (RPA70). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HSSB | MST075 | Replication factor A protein 1 | Replication protein A1 (70kD) | RF-A | RF-A protein 1 | MSTP075 | Replication protein A1, 70kDa | RP-A | RPA1 | REPA1 | RP-A p70 | RPA70
- UniProt Number
- P27694
- NCBI GenBank
- NM_002945 | NP_002936.1
- SwissProt
- P27694
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human RPA70 / RPA1
- Antigen Species
- Human
- Gene Name
- RPA1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR of human RPA1 were used as the immunogen for the RPA1 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
