Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:100.

IHC-plus™ CAST / Calpastatin Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$383.00each

Catalog Number: LS-B15589-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: Calpastatin antibody LS-B15589 is an unconjugated rabbit polyclonal antibody to Calpastatin (CAST) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Calpastatin | BS-17 | Calpain inhibitor | Sperm BS-17 component | CAST
Recommended Dilution: IHC-P: 1:100
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P20810
NCBI GenBank: NM_001750
SwissProt: P20810

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human CAST (NP_001177371.1). SDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPS
Immunogen Type: Synthetic Peptide (Linear)