Western blot analysis of extracts of K562 cell line, using CAST antibody.
CAST / Calpastatin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C330790-20
Catalog Number: LS-C330790
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Calpastatin antibody LS-C330790 is an unconjugated rabbit polyclonal antibody to Calpastatin (CAST) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Calpastatin | BS-17 | Calpain inhibitor | Sperm BS-17 component | CAST
- UniProt Number
- P20810
- NCBI GenBank
- NM_001750 | NP_001741.4
- SwissProt
- P20810
Target
- Target
- Human CAST / Calpastatin
- Antigen Species
- Human
- Epitope
- Human CAST / Calpastatin
- Gene Name
- CAST
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 600 to the C-Terminus of human CAST (NP_001177371.1). TIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS