Western blot testing of 1) rat brain, 2) human HeLa and 3) human Jurkat lysate with ARHGEF1 antibody at 0.5ug/ml. Predicted molecular weight ~102 kDa, but routinely observed at ~115 kDa.

ARHGEF1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C781845-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ARHGEF1 antibody LS-C781845 is an unconjugated rabbit polyclonal antibody to ARHGEF1 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: 115-kD protein | Arp2/3 complex 34 kd subunit | ARHGEF1 | GEF1 | LBCL2 | p115RhoGEF | LSC | Lsc homolog | SUB1.5 | p115-RHOGEF
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q92888
NCBI GenBank: NM_004706 | NP_004697.2
SwissProt: Q92888

Target

Target: Human ARHGEF1
Antigen Species: Human
Gene Name: ARHGEF1

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids 41-71 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) from the human protein were used as the immunogen for the ARHGEF1 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS