Western blot - Anti-ARHGEF1/Lsc Picoband Antibody

ARHGEF1 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C662332-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ARHGEF1 antibody LS-C662332 is an unconjugated rabbit polyclonal antibody to human ARHGEF1. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: 115-kD protein | Arp2/3 complex 34 kd subunit | ARHGEF1 | GEF1 | LBCL2 | p115RhoGEF | LSC | Lsc homolog | SUB1.5 | p115-RHOGEF
UniProt Number: Q92888
NCBI GenBank: NM_004706 | NP_004697.2
SwissProt: Q92888

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human ARHGEF1 (41-71 aa EQNSQFQSLEQVKRRPAHLMALLQHVALQFE), different from the related mouse and rat sequences by one amino acid.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl