SDF1 / CXCL12 Antibody
Catalog Number: LS-C104385
2 sizes / from $364.00
Antibody: Goat Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Western Blot
Reactivity: Mouse
Format: Lyophilized
Purified recombinant protein CXCL12 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human SDF1 / CXCL12 Protein (Recombinant Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$1130.00each
Catalog Number: LS-G67035-20
Catalog Number: LS-G67035
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Purified Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 1.
- Category
- Proteins & Peptides > Proteins > Recombinant Proteins
- Alternative Names
- C-X-C motif chemokine 12 | CXCL12 | HIRH | IRH | SDF-1 | SDF-1b | SDF1A | SDF1B | TPAR1 | TLSF-a | TLSF-b | SDF-1a | SDF1 | Sdf1alpha | Stromal cell-derived factor 1 | TLSF | HSDF-1 | PBSF | SCYB12
- Origin Species
- Human
- NCBI GenBank
- NM_000609
- SwissProt
- P48061
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 9.9 kDa
- Protein Type
- Recombinant
- Amino Acid Sequence
1MNAKVVVVLV LVLTALCLSD GKPVSLSYRC PCRFFESHVA RANVKHLKIL NTPNCALQIV61ARLKNNNRQV CIDPKLKWIQ EYLEKALNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
89 aa + 31 aa (cloning site & tags)
Format
- Purity
- >80%
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
- Concentration
- 0.11 mg/mL
- Purity Measurement Method
- SDS-PAGE (Coomassie Stain)
Storage & Handling
- Storage Conditions
- Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
