Western blot analysis of extracts of NCI-H292 cells, using CXCL12 antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
SDF1 / CXCL12 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408302-20
Catalog Number: LS-C408302
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CXCL12 antibody LS-C408302 is an unconjugated rabbit polyclonal antibody to CXCL12 (SDF1) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C-X-C motif chemokine 12 | CXCL12 | HIRH | IRH | SDF-1 | SDF-1b | SDF1A | SDF1B | TPAR1 | TLSF-a | TLSF-b | SDF-1a | SDF1 | Sdf1alpha | Stromal cell-derived factor 1 | TLSF | HSDF-1 | PBSF | SCYB12
- Recommended Dilution: WB
- 1:200 - 1:500
- UniProt Number
- P48061
- NCBI GenBank
- NM_000609 | NP_000600.1
- SwissProt
- P48061
Target
- Target
- Human SDF1 / CXCL12
- Antigen Species
- Human
- Epitope
- Human SDF1 / CXCL12
- Gene Name
- CXCL12
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 22-89 of human CXCL12 (NP_954637.1). KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS