CKS1B / CKS1 Antibody
Catalog Number: LS-C348979
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Purified recombinant protein CKS1B was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human CKS1B / CKS1 Protein (Recombinant Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$1130.00each
Catalog Number: LS-G65329-20
Catalog Number: LS-G65329
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Purified Recombinant protein of human CDC28 protein kinase regulatory subunit 1B (CKS1B), transcript variant 1.
- Category
- Proteins & Peptides > Proteins > Recombinant Proteins
- Alternative Names
- CDC28 protein kinase 1 | CKS-1 | CDC28 protein kinase 1B | CKS1B | Ckshs1 | PNAS-18 | PNAS-143 | PNAS-16 | CDC2-associated protein CKS1 | CKS1
- Origin Species
- Human
- NCBI GenBank
- NM_001826
- SwissProt
- P61024
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 9.5 kDa
- Protein Type
- Recombinant
- Amino Acid Sequence
1MSHKQIYYSD KYDDEEFEYR HVMLPKDIAK LVPKTHLMSE SEWRNLGVQQ SQGWVHYMIH61EPEPHILLFR RPLPKKPKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
79 aa + 31 aa (cloning site & tags)
Format
- Purity
- >80%
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
- Purity Measurement Method
- SDS-PAGE (Coomassie Stain)
Storage & Handling
- Storage Conditions
- Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
