CCL4 / MIP-1 Beta Antibody
Catalog Number: LS-C104786
2 sizes / from $364.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Western Blot
Reactivity: Human
Format: Lyophilized
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Human CCL4 / MIP-1 Beta Protein (Over-Expression Lysate Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293T |
| Format: | Lyophilized |
$153.00each
Catalog Number: LS-G77195-20
Catalog Number: LS-G77195
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- This product includes lyophilized lysate of HEK293T cells that have been transiently-tranfected with Human Macrophage Inflammatory Protein 1 beta(CCL4) (NM_002984) and is intended for use as a Western blot positive control. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4). See related products for a larger volume of this lysate supplied with a vector only control and 2x SDS-Page load buffer, or the purified form of this recombinant protein.
- Category
- Proteins & Peptides > Proteins > Lysates
- Alternative Names
- ACT2 | Act-2 | AT744.1 | C-C motif chemokine 4 | Chemokine (C-C motif) ligand 4 | CC chemokine ligand 4 | HC21 | LAG1 | MIP1B | MIP1B1 | LAG-1 | SCYA2 | Secreted protein G-26 | SIS-gamma | MIP-1-beta | MIP-1-beta(1-69) | Small-inducible cytokine A4 | T-cell activation protein 2 | CCL4 | G-26 | Lymphocyte-activation gene 1 | PAT 744 | Protein H400 | SCYA4
- Origin Species
- Human
- NCBI GenBank
- NM_002984
- SwissProt
- P13236
Protein
- Expression System
- Human Embryonic Kidney 293T
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 10 kDa
- Protein Type
- Lysate
- Amino Acid Sequence
1MKLCVTVLSL LMLVAAFCSP ALSAPMGSDP PTACCFSYTA RKLPRNFVVD YYETSSLCSQ61PAVVFQTKRS KQVCADPSES WVQEYVYDLE LNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
92 aa + 31 aa (cloning site & tags)
Format
- Purity
- Unpurified
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Lyophilized
- Formulation
- Lyophilized. 25mM Tris-HCl, pH 7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProtein inhibitor cocktail mix, 1mM PMSF and 1mM NA3VO4
Storage & Handling
- Storage Conditions
- Store at -20°C for up to 1 year. Avoid freeze-thaw cycles.
