AKAP7 Antibody
Catalog Number: LS-C375171
2 sizes / from $300.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Immunohistochemistry, Paraffin
Reactivity: Human
Format: Liquid
Purified recombinant protein AKAP7 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human AKAP7 Protein (Recombinant Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$1130.00each
Catalog Number: LS-G70065-20
Catalog Number: LS-G70065
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Purified Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant alpha.
- Category
- Proteins & Peptides > Proteins > Recombinant Proteins
- Alternative Names
- A-kinase anchor protein 9 kDa | A-kinase anchor protein 18 kDa | AKAP-7 isoforms alpha and beta | AKAP-7 isoform gamma | AKAP 18 | AKAP15 | AKAP18 | AKAP7 | PRKA7 isoform gamma | PRKA7 isoforms alpha/beta
- Origin Species
- Human
- NCBI GenBank
- NM_016377
- SwissProt
- Q9P0M2
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 8.8 kDa
- Protein Type
- Recombinant
- Amino Acid Sequence
1MGQLCCFPFS RDEGKISEKN GGEPDDAELV RLSKRLVENA VLKAVQQYLE ETQNKNKPGE61GSSVKTEAAD QNGNDNENNR KTRTRPLEQKLISEEDLAANDILDYKDDDDKV
81 aa + 31 aa (cloning site & tags)
Format
- Purity
- >80%
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
- Purity Measurement Method
- SDS-PAGE (Coomassie Stain)
Storage & Handling
- Storage Conditions
- Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
