UNC5H3 / UNC5C Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490512-100
Catalog Number: LS-C490512
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- UNC5C antibody LS-C490512 is an unconjugated rabbit polyclonal antibody to UNC5C (UNC5H3) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Unc-5 homolog 3 | UNC5H3 | Netrin receptor UNC5C | Protein unc-5 homolog 3 | Protein unc-5 homolog C | Unc-5 homolog C (C. elegans) | Unc5 (C.elegans homolog) c | UNC5C
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- O95185
- NCBI GenBank
- NM_003728 | NP_003719.3
- SwissProt
- O95185
Target
- Target
- Human UNC5H3 / UNC5C
- Antigen Species
- Human
- Gene Name
- UNC5C
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS