UNC5C antibody Western blot. All lanes: Anti UNC5C at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 115 kD. Observed band size: 115 kD.
UNC5H3 / UNC5C Antibody (aa894-930)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Guinea Pig, Horse, Human, Mammal (Other), Mouse, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408054-100
Catalog Number: LS-C408054
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- UNC5C antibody LS-C408054 is an unconjugated rabbit polyclonal antibody to UNC5C (UNC5H3) (aa894-930) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- GP, Hr, Hu, Mml, Ms, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Unc-5 homolog 3 | UNC5H3 | Netrin receptor UNC5C | Protein unc-5 homolog 3 | Protein unc-5 homolog C | Unc-5 homolog C (C. elegans) | Unc5 (C.elegans homolog) c | UNC5C
- UniProt Number
- O95185
- NCBI GenBank
- NM_003728 | NP_003719.3
- SwissProt
- O95185
Target
- Target
- Human UNC5H3 / UNC5C
- Antigen Species
- Human
- Epitope
- Mainly expressed in brain. Also expressed in kidney. Not expressed in developing or adult lung. .
- Gene Name
- UNC5C
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human UNC5C (894-930 aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl