Western blot analysis of UHRF1 expression in MCF-7 whole cell lysates (lane 1) and U2OS whole cell lysates (lane 2). UHRF1 at 90 kD was detected using rabbit anti- UHRF1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

UHRF1 Antibody (aa14-51)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Dog, Guinea Pig, Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C408117-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: UHRF1 antibody LS-C408117 is an unconjugated rabbit polyclonal antibody to UHRF1 (aa14-51) from human. It is reactive with human, dog and guinea pig. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Can, GP, Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HUHRF1 | HuNp95 | Nuclear protein 95 | RING finger protein 106 | UHRF1 | RNF106 | Transcription factor ICBP90 | HNP95 | ICBP90 | Np95
UniProt Number: Q96T88
NCBI GenBank: NM_013282 | NP_037414.3
SwissProt: Q96T88

Target

Target: Human UHRF1
Antigen Species: Human
Epitope: Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer. .
Gene Name: UHRF1

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human UHRF1 (14-51 aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl