Western blot testing of 1) human placenta, 2) human MCF7, 3) rat spleen and 4) mouse spleen lysate with SP6 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.

SP6 Transcription Factor Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

See all Human SP6 Transcription Factor antibodies â†’

$587.00each

Catalog Number: LS-C782082-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: SP6 Transcription Factor antibody LS-C782082 is an unconjugated rabbit polyclonal antibody to SP6 Transcription Factor from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: EPIPROFIN | Krueppel-like factor 14 | Kruppel-like factor 14 | SP6 | Sp6 transcription factor | Transcription factor Sp6 | EPFN
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q3SY56
NCBI GenBank: NP_954871.1
SwissProt: Q3SY56

Target

Target: Human SP6 Transcription Factor
Antigen Species: Human
Gene Name: SP6

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH from the human protein were used as the immunogen for the SP6 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.