SP6 Transcription Factor Antibody
Catalog Number: LS-C782082-100
100 µg / $587.00
Antibody: Rabbit Polyclonal
Applications: Western Blot
Reactivity: Human, Mouse, Rat
Format: Lyophilized
Western blot - Anti-SP6 Picoband antibody
SP6 Transcription Factor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662802-100
Catalog Number: LS-C662802
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SP6 Transcription Factor antibody LS-C662802 is an unconjugated rabbit polyclonal antibody to human SP6 Transcription Factor. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EPIPROFIN | Krueppel-like factor 14 | Kruppel-like factor 14 | SP6 | Sp6 transcription factor | Transcription factor Sp6 | EPFN
- UniProt Number
- Q3SY56
- NCBI GenBank
- NP_954871.1
- SwissProt
- Q3SY56
Target
- Target
- Human SP6 Transcription Factor
- Antigen Species
- Hu
- Epitope
- Ubiquitous.
- Gene Name
- SP6
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human SP6 (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH).
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
![Mouse Transcription Factor Ap-1 [Sus scrofa] ELISA Kit (Sandwich ELISA)](/_next/image?url=https%3A%2F%2Flb-assets.vectorlabs.com%2Fimages%2F255792_1927613.jpg&w=3840&q=75)
