SP2 antibody Western blot. All lanes: Anti SP2 at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 72 kD. Observed band size: 72 kD.

SP2 Antibody (aa312-343)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Bovine, Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Pig, Rabbit, Rat, Sheep
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407770-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: SP2 antibody LS-C407770 is an unconjugated rabbit polyclonal antibody to SP2 (aa312-343) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
Application: WB
Reactivity: Bov, Can, GP, Ham, Hr, Hu, Mml, Ms, Por, Rb, Rt, Sh
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: KIAA0048 | Sp2 transcription factor | SP2 | Transcription factor Sp2
UniProt Number: Q02086
NCBI GenBank: NM_003110 | NP_003101.3
SwissProt: Q02086

Target

Target: Human SP2
Antigen Species: Human
Gene Name: SP2

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SP2 (312-343 aa QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ), identical to the related mouse sequence.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl