Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)

SMAD4 Antibody (N-Terminus)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$383.00each

Catalog Number: LS-B11491-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: SMAD4 antibody LS-B11491 is an unconjugated rabbit polyclonal antibody to SMAD4 (N-Terminus) from human. It is reactive with human and mouse. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms
Intended Use: RUO
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: DPC4 | HSMAD4 | MYHRS | SMAD 4 | MAD homolog 4 | SMAD family member 4 | SMAD4 | JIP | MADH4 | Mothers against DPP homolog 4
Recommended Dilution: IHC-P: 15 µg/ml
Recommended Dilution: WB: 1 µg/ml
UniProt Number: Q13485
NCBI GenBank: NM_005359, NP_005350.1
SwissProt: Q13485

Immunogen: A synthetic peptide containing 14-22 aa derived from: MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEK

Storage Conditions: Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.
Recommended Storage Buffer: PBS