Western blot analysis of extracts of various cells.
SLC2A13 / HMIT / GLUT13 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C411474-20
Catalog Number: LS-C411474
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GLUT13 antibody LS-C411474 is an unconjugated rabbit polyclonal antibody to GLUT13 (SLC2A13 / HMIT) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- H(+)-myo-inositol symporter | HMIT | Glut13 | SLC2A13
- Recommended Dilution: WB
- 1:1000 - 1:4000
- UniProt Number
- Q96QE2
- NCBI GenBank
- NM_052885 | NP_443117.3
- SwissProt
- Q96QE2
Target
- Target
- Human SLC2A13 / HMIT / GLUT13
- Antigen Species
- Human
- Epitope
- Human SLC2A13 / HMIT / GLUT13
- Gene Name
- SLC2A13
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 564-648 of human SLC2A13 (NP_443117.3). LHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS