SLC22A7 / OAT2 Antibody (aa51-100)
Catalog Number: LS-C31903-100
100 µL (1 mg/mL) / $405.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity: Human
Format: Liquid
Western blot analysis of extracts of various cell lines, using SLC22A7 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
SLC22A7 / OAT2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C750108-20
Catalog Number: LS-C750108
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- OAT2 antibody LS-C750108 is an unconjugated rabbit polyclonal antibody to OAT2 (SLC22A7) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HOAT2 | Liver-specific transporter | OAT2 | Organic anion transporter 2 | SLC22A7 | NLT | Novel liver transporter
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9Y694
- NCBI GenBank
- NM_006672, NP_006663.2
- SwissProt
- Q9Y694
Target
- Target
- Human SLC22A7 / OAT2
- Antigen Species
- Hu
- Gene Name
- SLC22A7
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 50-142 of human SLC22A7 (NP_696961.2). ALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQKG
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
