Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
SLC22A2 antibody Western blot. All lanes: Anti SLC22A2 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Predicted band size: 63 kD. Observed band size: 63 kD.
SLC22A2 Antibody (aa524-555)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357581-100
Catalog Number: LS-C357581
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SLC22A2 antibody LS-C357581 is an unconjugated rabbit polyclonal antibody to SLC22A2 (aa524-555) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Cited in 1 publication.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HOCT2 | OCT2 | Organic cation transporter 2 | SLC22A2
- UniProt Number
- O15244
- NCBI GenBank
- NM_003058 | NP_003049.2
- SwissProt
- O15244
Target
- Target
- Human SLC22A2
- Antigen Species
- Human
- Epitope
- Mainly expressed in kidney. Localized at the luminal membrane and basolateral membrane of kidney distal tubule and proximal tubules. To a lower extent, expressed in neurons of the cerebral cortex and in various subcortical nuclei (at protein levels). Also detected in secretory phase endometrium; in scattered cells in the stroma. .
- Gene Name
- SLC22A2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555 aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
The Role of NF-kB in the Downregulation of Organic Cation Transporter 2 Expression and Renal Cation Secretion in Kidney Disease. Chao Han, Juan Zheng, Fengyi Wang, Qingyang Lu, Qingfa Chen, Ankang Hu, Michele Visentin, Gerd A Kullak-Ublick, Zhibo Gai, Lei Chu. Frontiers in medicine. 2022 January;8:800421. PubMed: 35059420 PMC: PMC8763702
