Polyclonal Chicken GFP Antibody (clone IQGFP6 Polyclonal, WB)
Catalog Number: LS-C827997-50
50 µL (1 mg/mL) / $492.00
Antibody: Chicken Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Western Blot
Format: Liquid
Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC-plus™ Polyclonal Rabbit anti-Human SLC22A2 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Rat |
| Format: | Liquid |
$383.00each
Catalog Number: LS-B15528-50
Catalog Number: LS-B15528
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SLC22A2 antibody LS-B15528 is an unconjugated rabbit polyclonal antibody to SLC22A2 from human. It is reactive with human and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HOCT2 | OCT2 | Organic cation transporter 2 | SLC22A2
- Recommended Dilution: IHC-P
- 1:100 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- O15244
- NCBI GenBank
- NM_003058 | NP_003049.2
- SwissProt
- O15244
Target
- Target
- SLC22A2
- Antigen Species
- Human
- Specificity
- Human SLC22A2
- Epitope
- Human SLC22A2
- Gene Name
- SLC22A2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 44-140 of human SLC22A2 (NP_003049.2). GFTPDHRCRSPGVAELSLRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFN
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
