SCARB1 antibody Western blot. All lanes: Anti SCARB1 at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Mouse Testis Tissue Lysate at 50 ug. Predicted band size: 57 kD. Observed band size: 57 kD.

SCARB1 / SR-BI Antibody (aa478-509)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Hamster, Mouse, Rat
Format:	Lyophilized

See all Mouse SCARB1 / SR-BI antibodies →

$480.00each

Catalog Number: LS-C407715-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: SR-BI antibody LS-C407715 is an unconjugated rabbit polyclonal antibody to SR-BI (SCARB1) (aa478-509) from mouse. It is reactive with mouse, rat and hamster. Validated for WB.
Application: WB
Reactivity: Ham, Ms, Rt
Intended Use: RUO
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CLA-1 | CLA1 | CD36 and LIMPII analogous 1 | CD36 antigen-like 1 | CD36L1 | HDLQTL6 | SCARB1 | SR-BI | SRB1 | CD36 antigen
UniProt Number: Q8WTV0
NCBI GenBank: NM_005505, NP_005496.4
SwissProt: Q8WTV0

Target

Target: Mouse SCARB1 / SR-BI
Antigen Species: Ms
Epitope: Expressed primarily in liver and non-placental steroidogenic tissues.
Gene Name: SCARB1

Antibody

Host Species: Rb
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of mouse SCARB1 (478-509 aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.
Immunogen Type: SP-Lin

Format

Conjugate/Label: Unconj
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: AP

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.