SCARB1 / SR-BI Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490177-100
Catalog Number: LS-C490177
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- SR-BI antibody LS-C490177 is an unconjugated rabbit polyclonal antibody to SR-BI (SCARB1) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CLA-1 | CLA1 | CD36 and LIMPII analogous 1 | CD36 antigen-like 1 | CD36L1 | HDLQTL6 | SCARB1 | SR-BI | SRB1 | CD36 antigen
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- Q8WTV0
- NCBI GenBank
- NM_005505 | NP_005496.4
- SwissProt
- Q8WTV0
Target
- Target
- Mouse SCARB1 / SR-BI
- Antigen Species
- Mouse
- Gene Name
- SCARB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL of mouse Srb1 were used as the immunogen for the Srb1 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS