Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
RAB18 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490464-100
Catalog Number: LS-C490464
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- RAB18 antibody LS-C490464 is an unconjugated rabbit polyclonal antibody to RAB18 from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- RAB18 | RAB18 small GTPase | RAB18LI1 | Ras-related protein Rab-18 | WARBM3
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- Q9NP72
- NCBI GenBank
- NM_021252 | NP_067075.1
- SwissProt
- Q9NP72
Target
- Target
- Human RAB18
- Antigen Species
- Human
- Gene Name
- RAB18
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE of human RAB18 were used as the immunogen for the RAB18 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
