Rab18 antibody Western blot. All lanes: Anti Rab18 at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Lung Tissue Lysate at 50 ug. Lane 3: 293T Whole Cell Lysate at 40 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: HEPG2 Whole Cell Lysate at 40 ug. Predicted band size: 23 kD. Observed band size: 23 kD.

RAB18 Antibody (aa156-192)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Hamster, Horse, Human, Mammal (Other), Mouse, Rat
Format:	Lyophilized

$480.00each

Catalog Number: LS-C408003-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: RAB18 antibody LS-C408003 is an unconjugated rabbit polyclonal antibody to RAB18 (aa156-192) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
Application: WB
Reactivity: Ham, Hr, Hu, Mml, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: RAB18 | RAB18 small GTPase | RAB18LI1 | Ras-related protein Rab-18 | WARBM3
UniProt Number: Q9NP72
NCBI GenBank: NM_021252 | NP_067075.1
SwissProt: Q9NP72

Target

Target: Human RAB18
Antigen Species: Human
Epitope: Ubiquitous.
Gene Name: RAB18

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human Rab18 (156-192 aa DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl