Western blot analysis of extracts of various cell lines, using RAB14 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

RAB14 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C747829-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: RAB14 antibody LS-C747829 is an unconjugated rabbit polyclonal antibody to human RAB14. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: F protein-binding protein 1 | FBP | RAB-14 | Ras-related protein Rab-14 | RAB14
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P61106
NCBI GenBank: NM_016322 | NP_057406.2
SwissProt: P61106

Target

Target: Human RAB14
Antigen Species: Human
Gene Name: RAB14

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 126-215 of human RAB14 (NP_057406.2). ADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)