RAB14 antibody Western blot. All lanes: Anti RAB14 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: RAJI Whole Cell Lysate at 40 ug. Lane 3: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 24 kD. Observed band size: 24 kD.

RAB14 Antibody (aa124-153)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Rat, Sheep
Format:	Lyophilized

$480.00each

Catalog Number: LS-C408027-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: RAB14 antibody LS-C408027 is an unconjugated rabbit polyclonal antibody to RAB14 (aa124-153) from human. It is reactive with human, rat and sheep. Validated for WB.
Application: WB
Reactivity: Hu, Rt, Sh
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: F protein-binding protein 1 | FBP | RAB-14 | Ras-related protein Rab-14 | RAB14
UniProt Number: P61106
NCBI GenBank: NM_016322 | NP_057406.2
SwissProt: P61106

Target

Target: Human RAB14
Antigen Species: Human
Gene Name: RAB14

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human RAB14 (124-153 aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA), identical to the related mouse and rat sequences.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl