Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot testing of mouse brain lysate with MC2R antibody at 0.5ug/ml. Predicted molecular weight: ~33 kDa (unmodified), ~43kDa (glycosylated).
Polyclonal Rabbit anti-Mouse MC2R / ACTHR / ACTH Receptor Antibody (WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781996-100
Catalog Number: LS-C781996
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ACTH Receptor antibody LS-C781996 is an unconjugated rabbit polyclonal antibody to ACTH Receptor (MC2R / ACTHR) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ACTHR | ACTH receptor | ACTH-R | Adrenocorticotropic receptor | Adrenocorticotropin receptor | MC2R | Melanocortin 2 receptor | Melanocortin receptor 2 | MC2-R | MC2 receptor
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q01718
- NCBI GenBank
- NM_000529, NP_000520.1
- SwissProt
- Q01718
Target
- Target
- Mouse MC2R / ACTHR / ACTH Receptor
- Antigen Species
- Ms
- Gene Name
- MC2R
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Amino acids 268-297 (NAVIDPFIYAFRSPELRDAFKKMIFCSRYW) from the human protein were used as the immunogen for the MC2R antibody.
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
