Western blot - Anti-MC2 receptor Picoband Antibody
MC2R / ACTHR / ACTH Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662145-100
Catalog Number: LS-C662145
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ACTH Receptor antibody LS-C662145 is an unconjugated rabbit polyclonal antibody to human ACTH Receptor (MC2R / ACTHR). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ACTHR | ACTH receptor | ACTH-R | Adrenocorticotropic receptor | Adrenocorticotropin receptor | MC2R | Melanocortin 2 receptor | Melanocortin receptor 2 | MC2-R | MC2 receptor
- UniProt Number
- Q01718
- NCBI GenBank
- NM_000529 | NP_000520.1
- SwissProt
- Q01718
Target
- Target
- Human MC2R / ACTHR / ACTH Receptor
- Antigen Species
- Human
- Epitope
- Melanocytes and corticoadrenal tissue.
- Gene Name
- MC2R
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human MC2 receptor (268-297 aa NAVIDPFIYAFRSPELRDAFKKMIFCSRYW), different from the related mouse sequence by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl