Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Immunoprecipitation analysis of 150ug extracts of HeLa cells.
Polyclonal Rabbit anti-Human TSG101 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunoprecipitation, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C497922-20
Catalog Number: LS-C497922
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TSG101 antibody LS-C497922 is an unconjugated rabbit polyclonal antibody to TSG101 from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.
- Application
- IHC, IP, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ESCRT-I complex subunit TSG101 | Tumor susceptibility gene 10 | TSG101 | Tumor susceptibility protein | VPS23 | Tumor susceptibility gene 101 | TSG10
- Recommended Dilution: IHC
- 1:50 - 1:100
- Recommended Dilution: IP
- 1:20 - 1:50
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q99816
- NCBI GenBank
- NM_006292 | NP_006283.1
- SwissProt
- Q99816
Target
- Target
- Human TSG101
- Antigen Species
- Human
- Gene Name
- TSG101
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human TSG101 (NP_006283.1). SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS with 0.09% Sodium azide,50% glycerol,pH7.3
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
