Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE)

IHC-plus™ TSG101 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$383.00each

Catalog Number: LS-B13375-50

Unit Size

Quantity

For bulk orders or custom formulations:

Description: TSG101 antibody LS-B13375 is an unconjugated rabbit polyclonal antibody to TSG101 from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ESCRT-I complex subunit TSG101 | Tumor susceptibility gene 10 | TSG101 | Tumor susceptibility protein | VPS23 | Tumor susceptibility gene 101 | TSG10
Recommended Dilution: IHC-P: 1:100
Recommended Dilution: WB: 1:200 - 1:2000
UniProt Number: Q99816
NCBI GenBank: NM_006292 | NP_006283.1
SwissProt: Q99816

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human TSG101 (NP_006283.1). SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Immunogen Type: Synthetic Peptide (Linear)