Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot analysis of extracts of various cells.
Polyclonal Rabbit anti-Human P2RY1 / P2Y1 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409261-20
Catalog Number: LS-C409261
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- P2Y1 antibody LS-C409261 is an unconjugated rabbit polyclonal antibody to P2Y1 (P2RY1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ATP receptor | p2Y1 | p2y1r | Platelet ADP receptor | Purinoceptor p2y1 | Purinergic receptor | p2 purinoceptor subtype Y1 | p2RY1 | p2Y purinoceptor 1 | p2y-1-r | Purinoceptor p2yr1 | p2y1 receptor | P2YR | Purinergic receptor P2Y, G-protein coupled, 1
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P47900
- NCBI GenBank
- NM_002563 | NP_002554.1
- SwissProt
- P47900
Target
- Target
- Human P2RY1 / P2Y1
- Antigen Species
- Human
- Epitope
- Human P2RY1 / P2Y1
- Gene Name
- P2RY1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 274-373 of human P2RY1 (NP_002554.1). IPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
