Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot testing of human 1) Jurkat and 2) COLO320 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
Polyclonal Rabbit anti-Human NFIA / Nuclear Factor 1 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781879-100
Catalog Number: LS-C781879
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Nuclear Factor 1 antibody LS-C781879 is an unconjugated rabbit polyclonal antibody to Nuclear Factor 1 (NFIA) from human. It is reactive with human, mouse and rat. Validated for Flow, IHC and WB.
- Application
- FC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CTF | NF1-A | NFIA | NF-I/A | NFI-L | Nuclear Factor 1 | TGGCA-binding protein | NFI-A | Nuclear factor 1 A-type | KIAA1439 | Nuclear factor 1/A | Nuclear factor I/A
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q12857
- NCBI GenBank
- NM_005595 | NP_005586.1
- SwissProt
- Q12857
Target
- Target
- Human NFIA / Nuclear Factor 1
- Antigen Species
- Human
- Gene Name
- NFIA
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 180-224 (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) from the human protein were used as the immunogen for the NFIA antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
