Western blot - Anti-NFIA Picoband Antibody

NFIA / Nuclear Factor 1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C661861-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: Nuclear Factor 1 antibody LS-C661861 is an unconjugated rabbit polyclonal antibody to human Nuclear Factor 1 (NFIA). Validated for Flow, ICC, IHC and WB.
Application: FC, ICC, IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CTF | NF1-A | NFIA | NF-I/A | NFI-L | Nuclear Factor 1 | TGGCA-binding protein | NFI-A | Nuclear factor 1 A-type | KIAA1439 | Nuclear factor 1/A | Nuclear factor I/A
UniProt Number: Q12857
NCBI GenBank: NM_005595 | NP_005586.1
SwissProt: Q12857

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224 aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSG VFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.