Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Neuropeptide Y antibody Western blot. All lanes: Anti Neuropeptide Y at 0.5 ug/ml. WB: COLO320 Whole Cell Lysate at 40 ug. Predicted band size: 11 kD. Observed band size: 30 kD.
Polyclonal Rabbit anti-Human Neuropeptide Y / NPY Antibody (aa29-64, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C357484-100
Catalog Number: LS-C357484
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NPY antibody LS-C357484 is an unconjugated rabbit polyclonal antibody to NPY (Neuropeptide Y) (aa29-64) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- NPY | Pro-neuropeptide Y | Neuropeptide Y | PYY4
- UniProt Number
- P01303
- NCBI GenBank
- NM_000905, NP_000896.1
- SwissProt
- P01303
Target
- Target
- Human Neuropeptide Y / NPY
- Antigen Species
- Hu
- Epitope
- One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
- Gene Name
- NPY
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64 aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
