Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
IHC-P: NPY antibody testing of mouse brain tissue
Polyclonal Rabbit anti-Human Neuropeptide Y / NPY Antibody (aa29-59, IHC)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin |
| Reactivity: | Dog, Guinea Pig, Hamster, Human, Mouse, Rabbit, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C388979-100
Catalog Number: LS-C388979
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- NPY antibody LS-C388979 is an unconjugated rabbit polyclonal antibody to NPY (Neuropeptide Y) (aa29-59) from human. It is reactive with human, mouse, rat and other species. Validated for IHC.
- Application
- IHC, IHC-P
- Reactivity
- Can, GP, Ham, Hu, Ms, Rb, Rt
- Predicted Reactivity
- Bovine, Chicken, Horse, Pig, Sheep, Xenopus
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- NPY | Pro-neuropeptide Y | Neuropeptide Y | PYY4
- UniProt Number
- P01303
- NCBI GenBank
- NM_000905 | NP_000896.1
- SwissProt
- P01303
Target
- Target
- Human Neuropeptide Y / NPY
- Antigen Species
- Human
- Epitope
- Human Neuropeptide Y / NPY
- Gene Name
- NPY
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Synthetic peptide from the middle region of human Neuropeptide Y (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY, aa29-59 of UniProt P01303). Percent identity by BLAST analysis: Human, Mouse, Rat, Ferret, Cat, Hamster, Rabbit, Guinea pig, Platypus, Dog (100%); Bovine, Elephant, Horse, Pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus (97%); Sheep (94%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Prior to reconstitution, 4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
