Polyclonal Rabbit anti-Human SLC5A11 / SMIT2 Antibody (WB)
Catalog Number: LS-C748223
2 sizes / from $281.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western blot analysis of extracts of various cell lines.
Polyclonal Rabbit anti-Human F2RL1 / PAR2 Antibody (WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C410329-20
Catalog Number: LS-C410329
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PAR2 antibody LS-C410329 is an unconjugated rabbit polyclonal antibody to human PAR2 (F2RL1). Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- F2RL1 | PAR2 | Thrombin receptor-like 1 | Protease-activated receptor 2 | G-protein coupled receptor 11 | GPR11 | PAR-2
- Recommended Dilution: WB
- 1:200 - 1:1000
- UniProt Number
- P55085
- NCBI GenBank
- NM_005242, NP_005233.3
- SwissProt
- P55085
Target
- Target
- Human F2RL1 / PAR2
- Antigen Species
- Hu
- Epitope
- Human F2RL1 / PAR2
- Gene Name
- F2RL1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 318-397 of human F2RL1 (NP_005233.3). GQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
