Western blot - Anti-CCR3 Picoband antibody

Polyclonal Rabbit anti-Human CCR3 Antibody (IHC, WB)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C662564-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: CCR3 antibody LS-C662564 is an unconjugated rabbit polyclonal antibody to human CCR3. Validated for Flow, ICC, IHC and WB.
Application: FC, ICC, IHC, WB
Reactivity: Hu
Intended Use: RUO
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: C-C chemokine receptor type 3 | B-chemokine receptor | CD193 | CD193 antigen | CCR3 | Chemokine c-c motif receptor 3 | C-C chemokine receptor 3 | CKR3 | CC-CKR-3 | CCR-3 | CMKBR3 | Eosinophil eotaxin receptor | Eotaxin receptor | C-C CKR-3 | CC chemokine receptor 3
UniProt Number: P51677
NCBI GenBank: NM_001837, NP_001828.1
SwissProt: P51677

Target: Human CCR3
Antigen Species: Hu
Epitope: In eosinophils as well as trace amounts in neutrophils and monocytes.
Gene Name: CCR3

Immunogen: A synthetic peptide corresponding to a sequence of human CCR3 (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA).
Immunogen Type: SP-Lin

Conjugate/Label: Unconj
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl