B3GNT8 Antibody (aa360-397)
Catalog Number: LS-C407898-100
100 µg / $480.00
Antibody: Rabbit Polyclonal
Applications: Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity: Human
Format: Lyophilized
Polyclonal Rabbit anti-Human B3GNT8 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490358-100
Catalog Number: LS-C490358
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- B3GNT8 antibody LS-C490358 is an unconjugated rabbit polyclonal antibody to human B3GNT8. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Recommended Dilution: IHC-P
- 0.5 - 1 µg/ml
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- NCBI GenBank
- NM_198540, NP_940942.1
Target
- Target
- Human B3GNT8
- Antigen Species
- Hu
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC of human B3GNT8 were used as the immunogen for the B3GNT8 antibody.
- Immunogen Type
- Pep
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
