B3GNT8 antibody Western blot. All lanes: Anti B3GNT8 at 0.5 ug/ml. WB: HELA Whole Cell Lysate at 40 ug. Predicted band size: 43 kD. Observed band size: 43 kD.

B3GNT8 Antibody (aa360-397)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407898-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: B3GNT8 antibody LS-C407898 is an unconjugated rabbit polyclonal antibody to human B3GNT8 (aa360-397). Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
NCBI GenBank: NM_198540 | NP_940942.1

Target

Target: Human B3GNT8
Antigen Species: Human
Epitope: Highly expressed in small intestine, pancreas, spleen, bone marrow, lung, throat, and ileum, and weakly in fetal brain, cerebellum, heart, liver, tongue, breast, uteri, and testis. Not detected in colon. Differentially expressed in human tumor cell lines. .

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human B3GNT8 (360-397 aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl