Western blot testing of human 1) HeLa, 2) placenta, 3) A549 and 4) SK-OV-3 lysate with DNA Polymerase iota antibody at 0.5ug/ml. Predicted molecular weight ~83 kDa.

POLI Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782106-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: POLI antibody LS-C782106 is an unconjugated rabbit polyclonal antibody to POLI from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: DNA polymerase iota | Eta2 | POLI | Polymerase (DNA directed) iota | RAD30 homolog B | RAD3OB | RAD30B
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q9UNA4
NCBI GenBank: NM_007195 | NP_009126.2
SwissProt: Q9UNA4

Target

Target: Human POLI
Antigen Species: Human
Gene Name: POLI

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK were used as the immunogen for the DNA Polymerase iota antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS