Polyclonal Chicken GFP Antibody (clone IQGFP6 Polyclonal, WB)
Catalog Number: LS-C827997-50
50 µL (1 mg/mL) / $492.00
Antibody: Chicken Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Western Blot
Format: Liquid
Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.
PathPlus™ Polyclonal Rabbit anti-Human NCAM / CD56 Antibody (aa759-858, IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$383.00each
Catalog Number: LS-B15335-100
Catalog Number: LS-B15335
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD56 antibody LS-B15335 is an unconjugated rabbit polyclonal antibody to CD56 (NCAM) (aa759-858) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CD56 | CD56 antigen | MSK39 | NCAM-1 | N-CAM-1 | NCAM | NCAM1
- Recommended Dilution: IHC-P
- 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P13591
- NCBI GenBank
- NM_000615 | NP_000606.3
- SwissProt
- P13591
Target
- Target
- NCAM / CD56
- Antigen Species
- Human
- Specificity
- Human NCAM / CD56
- Epitope
- Human NCAM / CD56
- Gene Name
- NCAM1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 759-858 of human NCAM1 (NP_851996.2). LCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, 50% glycerol, pH 7.3
- Volume
- 100 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
