Western blot analysis of extract of various cells.
NPY4R / PPYR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409679-20
Catalog Number: LS-C409679
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PPYR1 antibody LS-C409679 is an unconjugated rabbit polyclonal antibody to human PPYR1 (NPY4R). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Neuropeptide Y4 receptor | Neuropeptide Y receptor type 4 | NPY4R | PP1 | PPYR1 | Y4 | NPY4-R
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P50391
- NCBI GenBank
- NM_005972 | NP_005963.4
- SwissProt
- P50391
Target
- Target
- Human NPY4R / PPYR1
- Antigen Species
- Human
- Epitope
- Human NPY4R / PPYR1.
- Gene Name
- NPY4R|NPY4R2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human NPY4R (NP_005963.4). MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLI
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS