Western blot testing of human 1) HeLa, 2) MCF7, 3) HepG2, 4) A549 and 5) 293T cell lysate with NADPH oxidase 4 antibody at 0.5ug/ml. Expected molecular weight: ~65 kDa, 75-80 kDa.

NOX4 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782085-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: NOX4 antibody LS-C782085 is an unconjugated rabbit polyclonal antibody to NOX4 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Kidney oxidase-1 | KOX | RENOX | KOX-1 | NADPH oxidase 4 | NOX4 | Renal NAD(P)H-oxidase
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q9NPH5
NCBI GenBank: NM_016931 | NP_058627.1
SwissProt: Q9NPH5

Target

Target: Human NOX4
Antigen Species: Human
Gene Name: NOX4

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL were used as the immunogen for the NADPH oxidase 4 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS